![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins) |
![]() | Protein automated matches [190044] (14 species) not a true protein |
![]() | Species Cow (Bos taurus) [TaxId:9913] [187001] (23 PDB entries) |
![]() | Domain d3qk1a1: 3qk1 A:16-245 [184456] Other proteins in same PDB: d3qk1a2 automated match to d1aq7a_ complexed with ben, ca, edo, gol, imd, so4 |
PDB Entry: 3qk1 (more details), 2.08 Å
SCOPe Domain Sequences for d3qk1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qk1a1 b.47.1.2 (A:16-245) automated matches {Cow (Bos taurus) [TaxId: 9913]} ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg neqfisasksivhpsynkrrknndimliklksaaslnsrvasislptscasagtqclisg wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
Timeline for d3qk1a1: