SCOPe 2.07: Domain d3qk1a1: 3qk1 A:16-245

Lineage for d3qk1a1 (3qk1 A:16-245)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)

6. Protein automated matches [190044] (14 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [187001] (14 PDB entries)

8. Domain d3qk1a1: 3qk1 A:16-245 [184456]
   Other proteins in same PDB: d3qk1a2
   automated match to d1aq7a_
   complexed with ben, ca, edo, gol, imd, so4

Details for d3qk1a1

PDB Entry: 3qk1, 2.08 Å

PDB Description: Crystal Structure of Enterokinase-like Trypsin Variant

PDB Compounds: (A:) cationic trypsin

SCOPe Domain Sequences for d3qk1a1:

Sequence; same for both SEQRES and ATOM records:

>d3qk1a1 b.47.1.2 (A:16-245) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynkrrknndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d3qk1a1:

• d3qk1a1 first appeared in SCOPe 2.01, called d3qk1a_
  
• d3qk1a1 appears in SCOPe 2.06