Lineage for d3qjgi_ (3qjg I:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122192Fold c.34: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52506] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2122193Superfamily c.34.1: Homo-oligomeric flavin-containing Cys decarboxylases, HFCD [52507] (2 families) (S)
  5. 2122232Family c.34.1.0: automated matches [191535] (1 protein)
    not a true family
  6. 2122233Protein automated matches [190910] (5 species)
    not a true protein
  7. 2122256Species Staphylococcus aureus [TaxId:93062] [189637] (1 PDB entry)
  8. 2122265Domain d3qjgi_: 3qjg I: [184436]
    automated match to d1g63a_
    complexed with cl, fmn

Details for d3qjgi_

PDB Entry: 3qjg (more details), 2.04 Å

PDB Description: epidermin biosynthesis protein epid from staphylococcus aureus
PDB Compounds: (I:) Epidermin biosynthesis protein EpiD

SCOPe Domain Sequences for d3qjgi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qjgi_ c.34.1.0 (I:) automated matches {Staphylococcus aureus [TaxId: 93062]}
envliclcgsvnsinishyiielkskfdevnviastngrkfingeilkqfcdnyydefed
pflnhvdiankhdkiiilpatsntinkiangicdnllltichtafeklsifpnmnlrmwe
npvtqnnirllkdygvsiypanisesyelasktfkknvvapepykvlefi

SCOPe Domain Coordinates for d3qjgi_:

Click to download the PDB-style file with coordinates for d3qjgi_.
(The format of our PDB-style files is described here.)

Timeline for d3qjgi_: