![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.78: GntR ligand-binding domain-like [48007] (1 superfamily) core: 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
![]() | Superfamily a.78.1: GntR ligand-binding domain-like [48008] (1 family) ![]() |
![]() | Family a.78.1.1: GntR ligand-binding domain-like [48009] (2 proteins) |
![]() | Protein Fatty acid responsive transcription factor FadR, C-terminal domain [48010] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [48011] (5 PDB entries) |
![]() | Domain d1e2xa2: 1e2x A:79-227 [18443] Other proteins in same PDB: d1e2xa1 CASP4 complexed with so4 |
PDB Entry: 1e2x (more details), 2 Å
SCOPe Domain Sequences for d1e2xa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1e2xa2 a.78.1.1 (A:79-227) Fatty acid responsive transcription factor FadR, C-terminal domain {Escherichia coli [TaxId: 562]} glniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaqevlatanevadha dafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpearslalgfyhklsa lcsegahdqvyetvrryghesgeiwhrmq
Timeline for d1e2xa2: