![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.117: Thymidylate synthase/dCMP hydroxymethylase [55830] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.117.1: Thymidylate synthase/dCMP hydroxymethylase [55831] (2 families) ![]() automatically mapped to Pfam PF00303 |
![]() | Family d.117.1.1: Thymidylate synthase/dCMP hydroxymethylase [55832] (4 proteins) |
![]() | Protein automated matches [190469] (17 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [189990] (2 PDB entries) |
![]() | Domain d3qj7c_: 3qj7 C: [184415] Other proteins in same PDB: d3qj7d2 automated match to d1aiqa_ complexed with spm, ump |
PDB Entry: 3qj7 (more details), 2.5 Å
SCOPe Domain Sequences for d3qj7c_:
Sequence, based on SEQRES records: (download)
>d3qj7c_ d.117.1.1 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mtpyedllrfvletgtpksdrtgtgtrslfgqqmrydlsagfpllttkkvhfksvayell wflrgdsnigwlhehgvtiwdewasdtgelgpiygvqwrswpapsgehidqisaaldllr tdpdsrriivsawnvgeiermalppchaffqfyvadgrlscqlyqrsadlflgvpfnias yallthmmaaqaglsvgefiwtggdchiydnhveqvrlqlsreprpypkllladrdsife ytyedivvknydphpaikapv
>d3qj7c_ d.117.1.1 (C:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mtpyedllrfvletgtpksdgtgtrslfgqqmrydlsagfpllttkkvhfksvayellwf lrgdsnigwlhehgvtiwdewasdtgelgpiygvqwrswpapsgehidqisaaldllrtd pdsrriivsawnvgeiermalppchaffqfyvadgrlscqlyqrsadlflgvpfniasya llthmmaaqaglsvgefiwtggdchiydnhveqvrlqlsreprpypkllladrdsifeyt yedivvknydphpaikapv
Timeline for d3qj7c_:
![]() Domains from other chains: (mouse over for more information) d3qj7a_, d3qj7b_, d3qj7d1, d3qj7d2 |