Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) |
Family b.34.9.2: PWWP domain [69250] (6 proteins) includes the C-terminal all-alpha subdomain |
Protein automated matches [190966] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188600] (4 PDB entries) |
Domain d3qj6a_: 3qj6 A: [184412] automated match to d1n27a_ complexed with so4, unx |
PDB Entry: 3qj6 (more details), 2.3 Å
SCOPe Domain Sequences for d3qj6a_:
Sequence, based on SEQRES records: (download)
>d3qj6a_ b.34.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} phafkpgdlvfakmkgyphwpariddiadgavkpppnkypifffgthetaflgpkdlfpy dkckdkygkpnkrkgfneglweiqnnphasys
>d3qj6a_ b.34.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} phafkpgdlvfakmkgyphwpariddiaavkpppnkypifffgthetaflgpkdlfpydk ckdkygkpnkrkgfneglweiqnnphasys
Timeline for d3qj6a_: