Lineage for d3qj6a_ (3qj6 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 946133Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 947168Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families) (S)
  5. 947243Family b.34.9.2: PWWP domain [69250] (6 proteins)
    includes the C-terminal all-alpha subdomain
  6. 947265Protein automated matches [190966] (1 species)
    not a true protein
  7. 947266Species Human (Homo sapiens) [TaxId:9606] [188600] (4 PDB entries)
  8. 947276Domain d3qj6a_: 3qj6 A: [184412]
    automated match to d1n27a_
    complexed with so4, unx

Details for d3qj6a_

PDB Entry: 3qj6 (more details), 2.3 Å

PDB Description: the crystal structure of pwwp domain of human hepatoma-derived growth factor 2 in complex with h3k79me3 peptide
PDB Compounds: (A:) Hepatoma-derived growth factor-related protein 2

SCOPe Domain Sequences for d3qj6a_:

Sequence, based on SEQRES records: (download)

>d3qj6a_ b.34.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phafkpgdlvfakmkgyphwpariddiadgavkpppnkypifffgthetaflgpkdlfpy
dkckdkygkpnkrkgfneglweiqnnphasys

Sequence, based on observed residues (ATOM records): (download)

>d3qj6a_ b.34.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
phafkpgdlvfakmkgyphwpariddiaavkpppnkypifffgthetaflgpkdlfpydk
ckdkygkpnkrkgfneglweiqnnphasys

SCOPe Domain Coordinates for d3qj6a_:

Click to download the PDB-style file with coordinates for d3qj6a_.
(The format of our PDB-style files is described here.)

Timeline for d3qj6a_: