Lineage for d1hw1a2 (1hw1 A:79-230)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719075Fold a.78: GntR ligand-binding domain-like [48007] (1 superfamily)
    core: 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2719076Superfamily a.78.1: GntR ligand-binding domain-like [48008] (1 family) (S)
  5. 2719077Family a.78.1.1: GntR ligand-binding domain-like [48009] (2 proteins)
  6. 2719078Protein Fatty acid responsive transcription factor FadR, C-terminal domain [48010] (1 species)
  7. 2719079Species Escherichia coli [TaxId:562] [48011] (5 PDB entries)
  8. 2719080Domain d1hw1a2: 1hw1 A:79-230 [18441]
    Other proteins in same PDB: d1hw1a1, d1hw1b1
    protein/DNA complex; complexed with so4, zn

Details for d1hw1a2

PDB Entry: 1hw1 (more details), 1.5 Å

PDB Description: the fadr-dna complex: transcriptional control of fatty acid metabolism in escherichia coli
PDB Compounds: (A:) fatty acid metabolism regulator protein

SCOPe Domain Sequences for d1hw1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hw1a2 a.78.1.1 (A:79-230) Fatty acid responsive transcription factor FadR, C-terminal domain {Escherichia coli [TaxId: 562]}
glniletlarldhesvpqlidnllsvrtnistifirtafrqhpdkaqevlatanevadha
dafaeldynifrglafasgnpiyglilngmkglytrigrhyfanpearslalgfyhklsa
lcsegahdqvyetvrryghesgeiwhrmqknl

SCOPe Domain Coordinates for d1hw1a2:

Click to download the PDB-style file with coordinates for d1hw1a2.
(The format of our PDB-style files is described here.)

Timeline for d1hw1a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1hw1a1