Lineage for d3qina1 (3qin A:427-559)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2123751Superfamily c.55.3: Ribonuclease H-like [53098] (15 families) (S)
    consists of one domain of this fold
  5. 2123752Family c.55.3.1: Ribonuclease H [53099] (5 protein domains)
  6. 2123803Protein HIV RNase H (Domain of reverse transcriptase) [53105] (3 species)
  7. 2123804Species Hiv-1 m:b_hxb2r [TaxId:11706] [224897] (8 PDB entries)
  8. 2123806Domain d3qina1: 3qin A:427-559 [184407]
    Other proteins in same PDB: d3qina2
    automated match to d1o1wa_
    complexed with mn, p1y, so4

Details for d3qina1

PDB Entry: 3qin (more details), 1.7 Å

PDB Description: crystal structure of hiv-1 rnase h p15 with engineered e. coli loop and pyrimidinol carboxylic acid inhibitor
PDB Compounds: (A:) Gag-Pol polyprotein

SCOPe Domain Sequences for d3qina1:

Sequence, based on SEQRES records: (download)

>d3qina1 c.55.3.1 (A:427-559) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]}
yqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylal
qdsglevnivtdsqyalgiitqwihnwkkrgwktadkkpvknvdlvnqiieqlikkekvy
lawvpahkgiggneqvdklvsagirkv

Sequence, based on observed residues (ATOM records): (download)

>d3qina1 c.55.3.1 (A:427-559) HIV RNase H (Domain of reverse transcriptase) {Hiv-1 m:b_hxb2r [TaxId: 11706]}
yqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiylal
qdsglevnivtdsqyalgiitqwihnwkvknvdlvnqiieqlikkekvylawvpahkgig
gneqvdklvsagirkv

SCOPe Domain Coordinates for d3qina1:

Click to download the PDB-style file with coordinates for d3qina1.
(The format of our PDB-style files is described here.)

Timeline for d3qina1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qina2