Lineage for d3qimb_ (3qim B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2162069Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
  6. 2162796Protein Nickel-binding periplasmic protein NikA [102694] (2 species)
    similar domain organization to oligo- and dipeptide-binding protein
  7. 2162801Species Escherichia coli [TaxId:562] [102695] (26 PDB entries)
  8. 2162828Domain d3qimb_: 3qim B: [184406]
    automated match to d1zlqa1
    complexed with act, gol, so4

Details for d3qimb_

PDB Entry: 3qim (more details), 2.1 Å

PDB Description: Histidine 416 of the periplamsic binding protein NikA is essential for nickel uptake in Escherichia coli
PDB Compounds: (B:) Nickel-binding periplasmic protein

SCOPe Domain Sequences for d3qimb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qimb_ c.94.1.1 (B:) Nickel-binding periplasmic protein NikA {Escherichia coli [TaxId: 562]}
pdeittawpvnvgplnphlytpnqmfaqsmvyeplvkyqadgsvipwlakswthsedgkt
wtftlrddvkfsngepfdaeaaaenfravldnrqrhawlelanqivdvkalsktelqitl
ksayypflqelalprpfrfiapsqfknhetmngikapigtgpwilqesklnqydvfvrne
nywgekpaikkitfnvipdpttravafetgdidllygnegllpldtfarfsqnpayhtql
sqpietvmlalntakaptnelavrealnyavnkkslidnalygtqqvadtlfapsvpyan
lglkpsqydpqkakallekagwtlpagkdirekngqplrielsfigtdalsksmaeiiqa
dmrqigadvsligeeessiyarqrdgrfgmifhrtwgapydphaflssmrvpsiadfqaq
qgladkplidkeigevlathdetqrqalyrdiltrlhdeavylpisyismmvvskpelgn
ipyapiateipfeqikpv

SCOPe Domain Coordinates for d3qimb_:

Click to download the PDB-style file with coordinates for d3qimb_.
(The format of our PDB-style files is described here.)

Timeline for d3qimb_: