Lineage for d1d2zd_ (1d2z D:)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 4971Fold a.77: DEATH domain [47985] (1 superfamily)
  4. 4972Superfamily a.77.1: DEATH domain [47986] (1 family) (S)
  5. 4973Family a.77.1.1: DEATH domain [47987] (9 proteins)
  6. 5008Protein Tube death domain [48005] (1 species)
  7. 5009Species Drosophila melanogaster [TaxId:7227] [48006] (1 PDB entry)
  8. 5011Domain d1d2zd_: 1d2z D: [18440]
    Other proteins in same PDB: d1d2za_, d1d2zc_

Details for d1d2zd_

PDB Entry: 1d2z (more details), 2 Å

PDB Description: three-dimensional structure of a complex between the death domains of pelle and tube

SCOP Domain Sequences for d1d2zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2zd_ a.77.1.1 (D:) Tube death domain {Drosophila melanogaster}
lsskysrntelrrvedndiyrlakildenscwrklmsiipkgmdvqacsgagclnfpaei
kkgfkytaqdvfqideaanrlppdqsksqmmidewktsgklnerptvgvllqllvqaelf
saadfvaldflnestparpvdgpgalislelle

SCOP Domain Coordinates for d1d2zd_:

Click to download the PDB-style file with coordinates for d1d2zd_.
(The format of our PDB-style files is described here.)

Timeline for d1d2zd_: