Lineage for d3qi6d_ (3qi6 D:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132772Species Mycobacterium ulcerans [TaxId:362242] [189655] (2 PDB entries)
  8. 2132780Domain d3qi6d_: 3qi6 D: [184399]
    automated match to d1n8pa_
    complexed with edo, gol, na, so4

Details for d3qi6d_

PDB Entry: 3qi6 (more details), 1.91 Å

PDB Description: crystal structure of cystathionine gamma-synthase metb (cgs) from mycobacterium ulcerans agy99
PDB Compounds: (D:) Cystathionine gamma-synthase MetB (Cgs)

SCOPe Domain Sequences for d3qi6d_:

Sequence, based on SEQRES records: (download)

>d3qi6d_ c.67.1.0 (D:) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
faglatraihsgyrpdpatgavnapiyasstfaqdgvgglrggyeyartgnptrtaleaa
laavedaafgrafssgmaaadcalramlrpgdhvvipddayggtfrlidkvftgwnveyt
pvaladldavraairpttrliwvetptnpllsiadiagiaqlgadssakvlvdntfaspa
lqqplslgadvvlhsttkyigghsdvvggalvtndeeldqsfaflqngagavpgpfdayl
tmrglktlvlrmqrhsenaaavaeflaehpaistvlypglpshpghavaarqmrgfggmv
svrmragrtaaeqlcaktnifilaeslgsvesliehpsamthastagsqlevpddlvrls
vgiedvadllddlkqal

Sequence, based on observed residues (ATOM records): (download)

>d3qi6d_ c.67.1.0 (D:) automated matches {Mycobacterium ulcerans [TaxId: 362242]}
faglatraihsgyrpdpatgavnapiyasstfaqdgvgglrggyeyartgnptrtaleaa
laavedaafgrafssgmaaadcalramlrpgdhvvipddayggtfrlidkvftgwnveyt
pvaladldavraairpttrliwvetptnpllsiadiagiaqlgadssakvlvdntfaspa
lqqplslgadvvlhsttkyigghsdvvggalvtndeeldqsfaflqngagavpgpfdayl
tmrglktlvlrmqrhsenaaavaeflaehpaistvlypglpshpghavaarqmrgfggmv
svrmragrtaaeqlcaktnifilaeslgsvesliehpsamthgsqlevpddlvrlsvgie
dvadllddlkqal

SCOPe Domain Coordinates for d3qi6d_:

Click to download the PDB-style file with coordinates for d3qi6d_.
(The format of our PDB-style files is described here.)

Timeline for d3qi6d_: