SCOPe 2.07: Domain d3qi5b1: 3qi5 B:84-293

Lineage for d3qi5b1 (3qi5 B:84-293)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
   barrel, open; n*=6, S*=10; greek-key

4. Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families)

5. Family b.46.1.2: 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) [50490] (2 proteins)
   automatically mapped to Pfam PF02245

6. Protein automated matches [191235] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189662] (2 PDB entries)

8. Domain d3qi5b1: 3qi5 B:84-293 [184395]
   Other proteins in same PDB: d3qi5a2, d3qi5b2
   automated match to d1ewna_
   protein/DNA complex; complexed with mn

Details for d3qi5b1

PDB Entry: 3qi5, 2.2 Å

PDB Description: Crystal structure of human alkyladenine DNA glycosylase in complex with 3,N4-ethenocystosine containing duplex DNA

PDB Compounds: (B:) DNA-3-methyladenine glycosylase

SCOPe Domain Sequences for d3qi5b1:

Sequence, based on SEQRES records:

>d3qi5b1 b.46.1.2 (B:84-293) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrggrqt
prnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrstlrkg
tasrvlkdrelcsgpsklcqalainksfdqrdlaqdeavwlergplepsepavvaaarvg
vghagewarkplrfyvrgspwvsvvdrvae

Sequence, based on observed residues (ATOM records):

>d3qi5b1 b.46.1.2 (B:84-293) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrggrqt
prnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrstlrkg
trvlkdrelcsgpsklcqalainksfdqrdlaqdeavwlergplepsepavvaaarvgva
gewarkplrfyvrgspwvsvvdrvae

Timeline for d3qi5b1:

• d3qi5b1 first appeared in SCOPe 2.01, called d3qi5b_
  
• d3qi5b1 appears in SCOPe 2.06
  
• d3qi5b1 appears in the current release, SCOPe 2.08