Lineage for d3qi5b1 (3qi5 B:84-293)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055556Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2055557Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2055591Family b.46.1.2: 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) [50490] (2 protein domains)
    automatically mapped to Pfam PF02245
  6. 2055598Protein automated matches [191235] (1 species)
    not a true protein
  7. 2055599Species Human (Homo sapiens) [TaxId:9606] [189662] (2 PDB entries)
  8. 2055603Domain d3qi5b1: 3qi5 B:84-293 [184395]
    Other proteins in same PDB: d3qi5a2, d3qi5b2
    automated match to d1ewna_
    protein/DNA complex; complexed with mn

Details for d3qi5b1

PDB Entry: 3qi5 (more details), 2.2 Å

PDB Description: Crystal structure of human alkyladenine DNA glycosylase in complex with 3,N4-ethenocystosine containing duplex DNA
PDB Compounds: (B:) DNA-3-methyladenine glycosylase

SCOPe Domain Sequences for d3qi5b1:

Sequence, based on SEQRES records: (download)

>d3qi5b1 b.46.1.2 (B:84-293) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrggrqt
prnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrstlrkg
tasrvlkdrelcsgpsklcqalainksfdqrdlaqdeavwlergplepsepavvaaarvg
vghagewarkplrfyvrgspwvsvvdrvae

Sequence, based on observed residues (ATOM records): (download)

>d3qi5b1 b.46.1.2 (B:84-293) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrggrqt
prnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrstlrkg
trvlkdrelcsgpsklcqalainksfdqrdlaqdeavwlergplepsepavvaaarvgva
gewarkplrfyvrgspwvsvvdrvae

SCOPe Domain Coordinates for d3qi5b1:

Click to download the PDB-style file with coordinates for d3qi5b1.
(The format of our PDB-style files is described here.)

Timeline for d3qi5b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qi5b2