Lineage for d3qi5a1 (3qi5 A:84-294)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794501Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 2794502Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 2794536Family b.46.1.2: 3-methyladenine DNA glycosylase (AAG, ANPG, MPG) [50490] (2 proteins)
    automatically mapped to Pfam PF02245
  6. 2794543Protein automated matches [191235] (1 species)
    not a true protein
  7. 2794544Species Human (Homo sapiens) [TaxId:9606] [189662] (2 PDB entries)
  8. 2794547Domain d3qi5a1: 3qi5 A:84-294 [184394]
    Other proteins in same PDB: d3qi5a2, d3qi5b2
    automated match to d1ewna_
    protein/DNA complex; complexed with mn

Details for d3qi5a1

PDB Entry: 3qi5 (more details), 2.2 Å

PDB Description: Crystal structure of human alkyladenine DNA glycosylase in complex with 3,N4-ethenocystosine containing duplex DNA
PDB Compounds: (A:) DNA-3-methyladenine glycosylase

SCOPe Domain Sequences for d3qi5a1:

Sequence, based on SEQRES records: (download)

>d3qi5a1 b.46.1.2 (A:84-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrggrqt
prnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrstlrkg
tasrvlkdrelcsgpsklcqalainksfdqrdlaqdeavwlergplepsepavvaaarvg
vghagewarkplrfyvrgspwvsvvdrvaeq

Sequence, based on observed residues (ATOM records): (download)

>d3qi5a1 b.46.1.2 (A:84-294) automated matches {Human (Homo sapiens) [TaxId: 9606]}
trlgleffdqpavplaraflgqvlvrrlpngtelrgriveteaylgpedeaahsrggrqt
prnrgmfmkpgtlyvyiiygmyfcmnissqgdgacvllraleplegletmrqlrstlrkv
lkdrelcsgpsklcqalainksfdqrdlaqdeavwlergplepsepavvaaarvgvewar
kplrfyvrgspwvsvvdrvaeq

SCOPe Domain Coordinates for d3qi5a1:

Click to download the PDB-style file with coordinates for d3qi5a1.
(The format of our PDB-style files is described here.)

Timeline for d3qi5a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3qi5a2