Lineage for d1d2zb_ (1d2z B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004166Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2004167Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2004168Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 2004208Protein Tube death domain [48005] (1 species)
    complexed with Pelle death domain
  7. 2004209Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [48006] (1 PDB entry)
  8. 2004210Domain d1d2zb_: 1d2z B: [18439]
    Other proteins in same PDB: d1d2za_, d1d2zc1, d1d2zc2
    complexed with epe

Details for d1d2zb_

PDB Entry: 1d2z (more details), 2 Å

PDB Description: three-dimensional structure of a complex between the death domains of pelle and tube
PDB Compounds: (B:) death domain of tube

SCOPe Domain Sequences for d1d2zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d2zb_ a.77.1.2 (B:) Tube death domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
lsskysrntelrrvedndiyrlakildenscwrklmsiipkgmdvqacsgagclnfpaei
kkgfkytaqdvfqideaanrlppdqsksqmmidewktsgklnerptvgvllqllvqaelf
saadfvaldflnestparpvdgpgalisle

SCOPe Domain Coordinates for d1d2zb_:

Click to download the PDB-style file with coordinates for d1d2zb_.
(The format of our PDB-style files is described here.)

Timeline for d1d2zb_: