Lineage for d3qhtb_ (3qht B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1194674Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1194675Superfamily d.15.1: Ubiquitin-like [54236] (9 families) (S)
  5. 1194676Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 1195091Protein automated matches [190118] (8 species)
    not a true protein
  7. 1195092Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189675] (3 PDB entries)
  8. 1195095Domain d3qhtb_: 3qht B: [184387]
    automated match to d1euvb_
    complexed with gol

Details for d3qhtb_

PDB Entry: 3qht (more details), 2.4 Å

PDB Description: crystal structure of the monobody ysmb-1 bound to yeast sumo
PDB Compounds: (B:) Ubiquitin-like protein SMT3

SCOPe Domain Sequences for d3qhtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qhtb_ d.15.1.1 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
thinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtpedl
dmedndiieahre

SCOPe Domain Coordinates for d3qhtb_:

Click to download the PDB-style file with coordinates for d3qhtb_.
(The format of our PDB-style files is described here.)

Timeline for d3qhtb_: