Lineage for d3qhta_ (3qht A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2932413Protein automated matches [190118] (16 species)
    not a true protein
  7. 2932419Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [189675] (2 PDB entries)
  8. 2932421Domain d3qhta_: 3qht A: [184386]
    Other proteins in same PDB: d3qhtc_, d3qhtd_
    automated match to d1euvb_
    complexed with gol

Details for d3qhta_

PDB Entry: 3qht (more details), 2.4 Å

PDB Description: crystal structure of the monobody ysmb-1 bound to yeast sumo
PDB Compounds: (A:) Ubiquitin-like protein SMT3

SCOPe Domain Sequences for d3qhta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qhta_ d.15.1.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
kpethinlkvsdgsseiffkikkttplrrlmeafakrqgkemdslrflydgiriqadqtp
edldmedndiieahreqig

SCOPe Domain Coordinates for d3qhta_:

Click to download the PDB-style file with coordinates for d3qhta_.
(The format of our PDB-style files is described here.)

Timeline for d3qhta_: