![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.13: HIT-like [54196] (2 superfamilies) alpha-beta(3)-alpha-beta(2); 3 layers: alpha/beta/alpha |
![]() | Superfamily d.13.1: HIT-like [54197] (6 families) ![]() |
![]() | Family d.13.1.1: HIT (HINT, histidine triad) family of protein kinase-interacting proteins [54198] (8 proteins) Pfam PF01230 topologically similar to the N-terminal domain of protein kinases |
![]() | Protein Histidine triad nucleotide-binding protein (HINT) [54199] (2 species) |
![]() | Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [54200] (10 PDB entries) |
![]() | Domain d3qgza_: 3qgz A: [184383] automated match to d3rhna_ complexed with adn |
PDB Entry: 3qgz (more details), 1.1 Å
SCOPe Domain Sequences for d3qgza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qgza_ d.13.1.1 (A:) Histidine triad nucleotide-binding protein (HINT) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} pggdtifgkiirkeipakiifeddqclafhdispqapthflvipkkhisqisaaedades llghlmivgkkcaadlglkkgyrmvvnegsdggqsvyhvhlhvlggrqmnwppg
Timeline for d3qgza_: