Lineage for d3qgmd_ (3qgm D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2919479Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2919480Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 2920270Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 2920271Protein automated matches [190447] (55 species)
    not a true protein
  7. 2920285Species Archaeoglobus fulgidus [TaxId:2234] [189636] (2 PDB entries)
  8. 2920291Domain d3qgmd_: 3qgm D: [184382]
    automated match to d1vjra_
    complexed with ca, edo

Details for d3qgmd_

PDB Entry: 3qgm (more details), 2 Å

PDB Description: p-nitrophenyl phosphatase from archaeoglobus fulgidus
PDB Compounds: (D:) p-nitrophenyl phosphatase (Pho2)

SCOPe Domain Sequences for d3qgmd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qgmd_ c.108.1.0 (D:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mpdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrrillerlrsf
glevgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaeylvvg
snrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgrepdvv
vgkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttrenldqm
ierhglkpdyvfnslkdmveal

SCOPe Domain Coordinates for d3qgmd_:

Click to download the PDB-style file with coordinates for d3qgmd_.
(The format of our PDB-style files is described here.)

Timeline for d3qgmd_: