![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
![]() | Superfamily c.108.1: HAD-like [56784] (26 families) ![]() usually contains an insertion (sub)domain after strand 1 |
![]() | Family c.108.1.0: automated matches [191369] (1 protein) not a true family |
![]() | Protein automated matches [190447] (55 species) not a true protein |
![]() | Species Archaeoglobus fulgidus [TaxId:2234] [189636] (2 PDB entries) |
![]() | Domain d3qgmc_: 3qgm C: [184381] automated match to d1vjra_ complexed with ca, edo |
PDB Entry: 3qgm (more details), 2 Å
SCOPe Domain Sequences for d3qgmc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qgmc_ c.108.1.0 (C:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mpdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrrillerlrsf glevgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaeylvvg snrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgrepdvv vgkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttrenldqm ierhglkpdyvfnslkdmveal
Timeline for d3qgmc_: