Lineage for d3qgma_ (3qgm A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1010738Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 1010739Superfamily c.108.1: HAD-like [56784] (26 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 1011283Family c.108.1.0: automated matches [191369] (1 protein)
    not a true family
  6. 1011284Protein automated matches [190447] (20 species)
    not a true protein
  7. 1011290Species Archaeoglobus fulgidus [TaxId:2234] [189636] (1 PDB entry)
  8. 1011291Domain d3qgma_: 3qgm A: [184379]
    automated match to d1vjra_
    complexed with ca, edo

Details for d3qgma_

PDB Entry: 3qgm (more details), 2 Å

PDB Description: p-nitrophenyl phosphatase from archaeoglobus fulgidus
PDB Compounds: (A:) p-nitrophenyl phosphatase (Pho2)

SCOPe Domain Sequences for d3qgma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qgma_ c.108.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
pdkkgyiididgvigksvtpipegvegvkklkelgkkiifvsnnstrsrrillerlrsfg
levgedeilvatyatarfiarekpnakvfttgeeglieelrlagleivdydeaeylvvgs
nrkinfelmtkalraclrgiryiatnpdrifpaedgpipgtgmiigalywmtgrepdvvv
gkpsevimrealdilgldakdvavvgdqidvdvaagkaigaetvlvltgvttrenldqmi
erhglkpdyvfnslkdmveal

SCOPe Domain Coordinates for d3qgma_:

Click to download the PDB-style file with coordinates for d3qgma_.
(The format of our PDB-style files is described here.)

Timeline for d3qgma_: