SCOPe 2.02: Domain d3qe1a_: 3qe1 A:

Lineage for d3qe1a_ (3qe1 A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (3 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187666] (4 PDB entries)

8. Domain d3qe1a_: 3qe1 A: [184361]
   automated match to d1i92a_

Details for d3qe1a_

PDB Entry: 3qe1, 1.68 Å

PDB Description: crystal structure of pdz domain of sorting nexin 27 (snx27) fused to the c-terminal residues (eseskv) of girk3

PDB Compounds: (A:) Sorting nexin-27, G protein-activated inward rectifier potassium channel 3 chimera

SCOPe Domain Sequences for d3qe1a_:

Sequence; same for both SEQRES and ATOM records:

>d3qe1a_ b.36.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
sprvvrivksesgygfnvrgqvseggqlrsingelyaplqhvsavlpggaadragvrkgd
rilevngvnvegathkqvvdliragekeliltvlsveseskv

Timeline for d3qe1a_:

• d3qe1a_ first appeared in SCOPe 2.01
  
• d3qe1a_ appears in SCOPe 2.03
  
• d3qe1a_ appears in the current release, SCOPe 2.08, called d3qe1a1