SCOPe 2.01: Domain d3qdxa_: 3qdx A:

Lineage for d3qdxa_ (3qdx A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
   sandwich, 10 strands in 2 sheets;

4. Superfamily b.97.1: Cytolysin/lectin [63724] (2 families)
   some topological similarity to osmotin

5. Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins)
   Pfam PF07367

6. Protein automated matches [190758] (3 species)
   not a true protein

7. Species Boletus edulis [TaxId:36056] [189648] (7 PDB entries)

8. Domain d3qdxa_: 3qdx A: [184357]
   automated match to d1x99a_
   complexed with cbs

Details for d3qdxa_

PDB Entry: 3qdx, 1.7 Å

PDB Description: structure of the orthorhombic form of the boletus edulis lectin in complex with t-antigen disaccharide and n,n-diacetyl chitobiose

PDB Compounds: (A:) boletus edulis lectin

SCOPe Domain Sequences for d3qdxa_:

Sequence; same for both SEQRES and ATOM records:

>d3qdxa_ b.97.1.2 (A:) automated matches {Boletus edulis [TaxId: 36056]}
tysitlrvfqrnpgrgffsivektvfhyanggtwseakgthtltmggsgtsgvlrfmsdk
gelitvavgvhnykrwcdvvtglkpeetalvinpqyynngpraytrekqlaeynvtsvvg
trfevkytvvegnnleanvifs

Timeline for d3qdxa_:

• d3qdxa_ is new in SCOPe 2.01-stable
  
• d3qdxa_ appears in SCOPe 2.02
  
• d3qdxa_ appears in the current release, SCOPe 2.08