SCOPe 2.01: Domain d3qdva_: 3qdv A:

Lineage for d3qdva_ (3qdv A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
   sandwich, 10 strands in 2 sheets;

4. Superfamily b.97.1: Cytolysin/lectin [63724] (2 families)
   some topological similarity to osmotin

5. Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins)
   Pfam PF07367

6. Protein automated matches [190758] (3 species)
   not a true protein

7. Species Boletus edulis [TaxId:36056] [189648] (7 PDB entries)

8. Domain d3qdva_: 3qdv A: [184353]
   automated match to d1x99a_
   complexed with a2g, ndg

Details for d3qdva_

PDB Entry: 3qdv, 1.3 Å

PDB Description: structure of the orthorhombic form of the boletus edulis lectin in complex with n-acetyl glucosamine and n-acetyl galactosamine

PDB Compounds: (A:) boletus edulis lectin

SCOPe Domain Sequences for d3qdva_:

Sequence; same for both SEQRES and ATOM records:

>d3qdva_ b.97.1.2 (A:) automated matches {Boletus edulis [TaxId: 36056]}
tysitlrvfqrnpgrgffsivektvfhyanggtwseakgthtltmggsgtsgvlrfmsdk
gelitvavgvhnykrwcdvvtglkpeetalvinpqyynngpraytrekqlaeynvtsvvg
trfevkytvvegnnleanvifs

Timeline for d3qdva_:

• d3qdva_ is new in SCOPe 2.01-stable
  
• d3qdva_ appears in SCOPe 2.02
  
• d3qdva_ appears in the current release, SCOPe 2.08