SCOPe 2.06: Domain d3qdub_: 3qdu B:

Lineage for d3qdub_ (3qdu B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
   sandwich, 10 strands in 2 sheets;

4. Superfamily b.97.1: Cytolysin/lectin [63724] (2 families)
   some topological similarity to osmotin

5. Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins)
   Pfam PF07367

6. Protein automated matches [190758] (3 species)
   not a true protein

7. Species Boletus edulis [TaxId:36056] [189648] (7 PDB entries)

8. Domain d3qdub_: 3qdu B: [184350]
   automated match to d1x99a_
   complexed with cbs

Details for d3qdub_

PDB Entry: 3qdu, 2 Å

PDB Description: structure of boletus edulis lectin in complex with n,n-diacetyl chitobiose

PDB Compounds: (B:) boletus edulis lectin

SCOPe Domain Sequences for d3qdub_:

Sequence; same for both SEQRES and ATOM records:

>d3qdub_ b.97.1.2 (B:) automated matches {Boletus edulis [TaxId: 36056]}
tysitlrvfqrnpgrgffsivektvfhyanggtwseakgthtltmggsgtsgvlrfmsdk
gelitvavgvhnykrwcdvvtglkpeetalvinpqyynngpraytrekqlaeynvtsvvg
trfevkytvvegnnleanvifs

Timeline for d3qdub_:

• d3qdub_ first appeared in SCOPe 2.01
  
• d3qdub_ appears in SCOPe 2.05
  
• d3qdub_ appears in SCOPe 2.07
  
• d3qdub_ appears in the current release, SCOPe 2.08