Class b: All beta proteins [48724] (177 folds) |
Fold b.97: Cytolysin/lectin [63723] (1 superfamily) sandwich, 10 strands in 2 sheets; |
Superfamily b.97.1: Cytolysin/lectin [63724] (2 families) some topological similarity to osmotin |
Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins) Pfam PF07367 |
Protein automated matches [190758] (3 species) not a true protein |
Species Boletus edulis [TaxId:36056] [189648] (7 PDB entries) |
Domain d3qdub_: 3qdu B: [184350] automated match to d1x99a_ complexed with cbs |
PDB Entry: 3qdu (more details), 2 Å
SCOPe Domain Sequences for d3qdub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qdub_ b.97.1.2 (B:) automated matches {Boletus edulis [TaxId: 36056]} tysitlrvfqrnpgrgffsivektvfhyanggtwseakgthtltmggsgtsgvlrfmsdk gelitvavgvhnykrwcdvvtglkpeetalvinpqyynngpraytrekqlaeynvtsvvg trfevkytvvegnnleanvifs
Timeline for d3qdub_: