Lineage for d3ygsp1 (3ygs P:2-97)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332045Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2332046Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2332115Family a.77.1.3: Caspase recruitment domain, CARD [81313] (6 proteins)
  6. 2332136Protein Procaspase 9 prodomain [47999] (1 species)
  7. 2332137Species Human (Homo sapiens) [TaxId:9606] [48000] (1 PDB entry)
  8. 2332138Domain d3ygsp1: 3ygs P:2-97 [18435]
    Other proteins in same PDB: d3ygsc_, d3ygsp2

Details for d3ygsp1

PDB Entry: 3ygs (more details), 2.5 Å

PDB Description: apaf-1 card in complex with prodomain of procaspase-9
PDB Compounds: (P:) procaspase 9

SCOPe Domain Sequences for d3ygsp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ygsp1 a.77.1.3 (P:2-97) Procaspase 9 prodomain {Human (Homo sapiens) [TaxId: 9606]}
mdeadrrllrrcrlrlveelqvdqlwdvllsrelfrphmiediqragsgsrrdqarqlii
dletrgsqalplfiscledtgqdmlasflrtnrqag

SCOPe Domain Coordinates for d3ygsp1:

Click to download the PDB-style file with coordinates for d3ygsp1.
(The format of our PDB-style files is described here.)

Timeline for d3ygsp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ygsp2
View in 3D
Domains from other chains:
(mouse over for more information)
d3ygsc_