SCOPe 2.05: Domain d3qdtb_: 3qdt B:

Lineage for d3qdtb_ (3qdt B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
   sandwich, 10 strands in 2 sheets;

4. Superfamily b.97.1: Cytolysin/lectin [63724] (2 families)
   some topological similarity to osmotin

5. Family b.97.1.2: Fungal fruit body lectin [117119] (3 proteins)
   Pfam PF07367

6. Protein automated matches [190758] (3 species)
   not a true protein

7. Species Boletus edulis [TaxId:36056] [189648] (7 PDB entries)

8. Domain d3qdtb_: 3qdt B: [184348]
   automated match to d1x99a_

Details for d3qdtb_

PDB Entry: 3qdt, 1.3 Å

PDB Description: structure of boletus edulis lectin in complex with t-antigen disaccharide

PDB Compounds: (B:) boletus edulis lectin

SCOPe Domain Sequences for d3qdtb_:

Sequence; same for both SEQRES and ATOM records:

>d3qdtb_ b.97.1.2 (B:) automated matches {Boletus edulis [TaxId: 36056]}
tysitlrvfqrnpgrgffsivektvfhyanggtwseakgthtltmggsgtsgvlrfmsdk
gelitvavgvhnykrwcdvvtglkpeetalvinpqyynngpraytrekqlaeynvtsvvg
trfevkytvvegnnleanvifs

Timeline for d3qdtb_:

• d3qdtb_ first appeared in SCOPe 2.01
  
• d3qdtb_ appears in SCOPe 2.04
  
• d3qdtb_ appears in SCOPe 2.06
  
• d3qdtb_ appears in the current release, SCOPe 2.08