SCOPe 2.08: Domain d1cwwa1: 1cww A:1-97

Lineage for d1cwwa1 (1cww A:1-97)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.77: DEATH domain [47985] (1 superfamily)
   6 helices: closed bundle; greek-key; internal pseudo twofold symmetry

4. Superfamily a.77.1: DEATH domain [47986] (5 families)

5. Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins)

6. Protein Apoptotic protease activating factor 1, APAF-1 [47997] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47998] (7 PDB entries)

8. Domain d1cwwa1: 1cww A:1-97 [18434]
   Other proteins in same PDB: d1cwwa2

Details for d1cwwa1

PDB Entry: 1cww

PDB Description: solution structure of the caspase recruitment domain (card) from apaf- 1

PDB Compounds: (A:) apoptotic protease activating factor 1

SCOPe Domain Sequences for d1cwwa1:

Sequence; same for both SEQRES and ATOM records:

>d1cwwa1 a.77.1.3 (A:1-97) Apoptotic protease activating factor 1, APAF-1 {Human (Homo sapiens) [TaxId: 9606]}
mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
lkkdndsyvsfynallhegykdlaallhdgipvvsss

Timeline for d1cwwa1:

• d1cwwa1 first appeared (with stable ids) in SCOP 1.55, called d1cwwa_
  
• d1cwwa1 appears in SCOPe 2.07