Lineage for d1cwwa1 (1cww A:1-97)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718930Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2718931Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2719000Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins)
  6. 2719001Protein Apoptotic protease activating factor 1, APAF-1 [47997] (1 species)
  7. 2719002Species Human (Homo sapiens) [TaxId:9606] [47998] (7 PDB entries)
  8. 2719013Domain d1cwwa1: 1cww A:1-97 [18434]
    Other proteins in same PDB: d1cwwa2

Details for d1cwwa1

PDB Entry: 1cww (more details)

PDB Description: solution structure of the caspase recruitment domain (card) from apaf- 1
PDB Compounds: (A:) apoptotic protease activating factor 1

SCOPe Domain Sequences for d1cwwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cwwa1 a.77.1.3 (A:1-97) Apoptotic protease activating factor 1, APAF-1 {Human (Homo sapiens) [TaxId: 9606]}
mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
lkkdndsyvsfynallhegykdlaallhdgipvvsss

SCOPe Domain Coordinates for d1cwwa1:

Click to download the PDB-style file with coordinates for d1cwwa1.
(The format of our PDB-style files is described here.)

Timeline for d1cwwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cwwa2