Lineage for d3qcac_ (3qca C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932685Family d.15.1.2: UBX domain [54250] (6 proteins)
    Pfam PF00789
  6. 2932705Protein automated matches [191298] (1 species)
    not a true protein
  7. 2932706Species Human (Homo sapiens) [TaxId:9606] [189969] (6 PDB entries)
  8. 2932714Domain d3qcac_: 3qca C: [184337]
    automated match to d1h8ca_

Details for d3qcac_

PDB Entry: 3qca (more details), 2.9 Å

PDB Description: Crystal Structure of FAF1 UBX Domain In Complex with p97/VCP N Domain Reveals The Conserved FcisP Touch-Turn Motif of UBX Domain Suffering Conformational Change
PDB Compounds: (C:) fas-associated factor 1

SCOPe Domain Sequences for d3qcac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qcac_ d.15.1.2 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldpn
ksllevklfpqetlfleake

SCOPe Domain Coordinates for d3qcac_:

Click to download the PDB-style file with coordinates for d3qcac_.
(The format of our PDB-style files is described here.)

Timeline for d3qcac_: