| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
| Family d.15.1.2: UBX domain [54250] (6 proteins) Pfam PF00789 |
| Protein automated matches [191298] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [189969] (6 PDB entries) |
| Domain d3qcaa_: 3qca A: [184335] automated match to d1h8ca_ |
PDB Entry: 3qca (more details), 2.9 Å
SCOPe Domain Sequences for d3qcaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qcaa_ d.15.1.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
epvsklrirtpsgeflerrflasnklqivfdfvaskgfpwdeykllstfprrdvtqldpn
ksllevklfpqetlfleake
Timeline for d3qcaa_: