SCOPe 2.05: Domain d3qbya_: 3qby A:

Lineage for d3qbya_ (3qby A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.9: Tudor/PWWP/MBT [63748] (5 families)

5. Family b.34.9.2: PWWP domain [69250] (6 proteins)
   includes the C-terminal all-alpha subdomain

6. Protein automated matches [190966] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188600] (7 PDB entries)

8. Domain d3qbya_: 3qby A: [184330]
   automated match to d1n27a_
   complexed with so4, unx

Details for d3qbya_

PDB Entry: 3qby, 1.95 Å

PDB Description: crystal structure of the pwwp domain of human hepatoma-derived growth factor 2

PDB Compounds: (A:) Hepatoma-derived growth factor-related protein 2

SCOPe Domain Sequences for d3qbya_:

Sequence; same for both SEQRES and ATOM records:

>d3qbya_ b.34.9.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mphafkpgdlvfakmkgyphwpariddiadgavkpppnkypifffgthetaflgpkdlfp
ydkckdkygkpnkrkgfneglweiqnnphasys

Timeline for d3qbya_:

• d3qbya_ first appeared in SCOPe 2.01
  
• d3qbya_ appears in SCOPe 2.04
  
• d3qbya_ appears in SCOPe 2.06
  
• d3qbya_ appears in the current release, SCOPe 2.08