Lineage for d1c15a_ (1c15 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. Family a.77.1.3: Caspase recruitment domain, CARD [81313] (7 proteins)
  6. Protein Apoptotic protease activating factor 1, APAF-1 [47997] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47998] (7 PDB entries)
  8. Domain d1c15a_: 1c15 A: [18433]

Details for d1c15a_

PDB Entry: 1c15 (more details)

PDB Description: solution structure of apaf-1 card
PDB Compounds: (A:) apoptotic protease activating factor 1

SCOPe Domain Sequences for d1c15a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c15a_ a.77.1.3 (A:) Apoptotic protease activating factor 1, APAF-1 {Human (Homo sapiens) [TaxId: 9606]}
mdakarncllqhrealekdiktsyimdhmisdgfltiseeekvrneptqqqraamlikmi
lkkdndsyvsfynallhegykdlaallhdgipvvsss

SCOPe Domain Coordinates for d1c15a_ are not available.

Timeline for d1c15a_: