SCOPe 2.07: Domain d3qbtg_: 3qbt G:

Lineage for d3qbtg_ (3qbt G:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (80 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (34 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries)

8. Domain d3qbtg_: 3qbt G: [184329]
   automated match to d2fu5c1
   complexed with gnp, mg, so4

Details for d3qbtg_

PDB Entry: 3qbt, 2 Å

PDB Description: Crystal structure of OCRL1 540-678 in complex with Rab8a:GppNHp

PDB Compounds: (G:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d3qbtg_:

Sequence; same for both SEQRES and ATOM records:

>d3qbtg_ c.37.1.8 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdtag
qerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdvn
dkrqvskergeklaldygikfmetsakaninvenafftlardikakmdk

Timeline for d3qbtg_:

• d3qbtg_ first appeared in SCOPe 2.01
  
• d3qbtg_ appears in SCOPe 2.06
  
• d3qbtg_ appears in the current release, SCOPe 2.08