Lineage for d3qbtg_ (3qbt G:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2124192Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2125254Protein automated matches [190047] (29 species)
    not a true protein
  7. 2125340Species Human (Homo sapiens) [TaxId:9606] [186768] (179 PDB entries)
  8. 2125472Domain d3qbtg_: 3qbt G: [184329]
    automated match to d2fu5c1
    complexed with gnp, mg, so4

Details for d3qbtg_

PDB Entry: 3qbt (more details), 2 Å

PDB Description: Crystal structure of OCRL1 540-678 in complex with Rab8a:GppNHp
PDB Compounds: (G:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d3qbtg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qbtg_ c.37.1.8 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdtag
qerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdvn
dkrqvskergeklaldygikfmetsakaninvenafftlardikakmdk

SCOPe Domain Coordinates for d3qbtg_:

Click to download the PDB-style file with coordinates for d3qbtg_.
(The format of our PDB-style files is described here.)

Timeline for d3qbtg_: