SCOPe 2.03: Domain d3qbtc_: 3qbt C:

Lineage for d3qbtc_ (3qbt C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186768] (113 PDB entries)

8. Domain d3qbtc_: 3qbt C: [184327]
   automated match to d2fu5c1
   complexed with gnp, mg, so4

Details for d3qbtc_

PDB Entry: 3qbt, 2 Å

PDB Description: Crystal structure of OCRL1 540-678 in complex with Rab8a:GppNHp

PDB Compounds: (C:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d3qbtc_:

Sequence; same for both SEQRES and ATOM records:

>d3qbtc_ c.37.1.8 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdta
gqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdv
ndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk

Timeline for d3qbtc_:

• d3qbtc_ first appeared in SCOPe 2.01
  
• d3qbtc_ appears in SCOPe 2.02
  
• d3qbtc_ appears in SCOPe 2.04
  
• d3qbtc_ appears in the current release, SCOPe 2.08