SCOPe 2.01: Domain d3qbqa_: 3qbq A:

Lineage for d3qbqa_ (3qbq A:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.22: TNF-like [49841] (1 superfamily)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.22.1: TNF-like [49842] (2 families)

5. Family b.22.1.1: TNF-like [49843] (15 proteins)

6. Protein TRANCE/RANKL cytokine [63721] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [63722] (4 PDB entries)

8. Domain d3qbqa_: 3qbq A: [184324]
   automated match to d1iqaa_

Details for d3qbqa_

PDB Entry: 3qbq, 2.5 Å

PDB Description: crystal structure of extracellular domains of mouse rank-rankl complex

PDB Compounds: (A:) tumor necrosis factor ligand superfamily member 11

SCOPe Domain Sequences for d3qbqa_:

Sequence; same for both SEQRES and ATOM records:

>d3qbqa_ b.22.1.1 (A:) TRANCE/RANKL cytokine {Mouse (Mus musculus) [TaxId: 10090]}
aqpfahltinaasipsgshkvtlsswyhdrgwakisnmtlsngklrvnqdgfyylyanic
frhhetsgsvptdylqlmvyvvktsikipsshnlmkggstknwsgnsefhfysinvggff
klrageeisiqvsnpslldpdqdatyfgafkvqdi

Timeline for d3qbqa_:

• d3qbqa_ is new in SCOPe 2.01-stable
  
• d3qbqa_ appears in SCOPe 2.02
  
• d3qbqa_ appears in the current release, SCOPe 2.08