SCOPe 2.05: Domain d3qboa_: 3qbo A:

Lineage for d3qboa_ (3qbo A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
   formerly omega-Aminoacid:pyruvate aminotransferase-like

6. Protein automated matches [190152] (18 species)
   not a true protein

7. Species Yersinia pestis [TaxId:214092] [189635] (1 PDB entry)

8. Domain d3qboa_: 3qbo A: [184322]
   automated match to d1bjna_
   complexed with plp

Details for d3qboa_

PDB Entry: 3qbo, 2.36 Å

PDB Description: Crystal structure of phosphoserine aminotransferase from Yersinia pestis CO92

PDB Compounds: (A:) phosphoserine aminotransferase

SCOPe Domain Sequences for d3qboa_:

Sequence; same for both SEQRES and ATOM records:

>d3qboa_ c.67.1.4 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
qvynfsagpamlpvevlrraqqelrdwhglgtsvmevshrskefmqvaeesekdlrdlln
vpanykvlfchggaraqfaavplnllgdrnsadyvdggywahsaikeaqkyctpnvidvt
thdngltgiqpmkqwklsdnaayvhycpnetidgiaideqpdfgnkvvvadfsssilsrp
idvsrygviyagaqknigpagltlvivredllgkahtalpsildykiladndsmfntppt
fawylsglvfkwlkeqgglgemekrnqakaellygaidrtgfyrndvaitnrswmnvpfq
madasldklflseaeaqglqalkghrvaggmrasiynampiegvkaltdfmadferrh

Timeline for d3qboa_:

• d3qboa_ first appeared in SCOPe 2.01
  
• d3qboa_ appears in SCOPe 2.04
  
• d3qboa_ appears in SCOPe 2.06
  
• d3qboa_ appears in the current release, SCOPe 2.08