SCOPe 2.06: Domain d3qb5b_: 3qb5 B:

Lineage for d3qb5b_ (3qb5 B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.16: Translin [74784] (2 families)
   automatically mapped to Pfam PF01997

5. Family a.118.16.1: Translin [74785] (2 proteins)

6. Protein automated matches [191293] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189950] (4 PDB entries)

8. Domain d3qb5b_: 3qb5 B: [184315]
   automated match to d1keyb_
   complexed with cl, mn, na, po4, so4

Details for d3qb5b_

PDB Entry: 3qb5, 2.95 Å

PDB Description: Human C3PO complex in the presence of MnSO4

PDB Compounds: (B:) Translin

SCOPe Domain Sequences for d3qb5b_:

Sequence; same for both SEQRES and ATOM records:

>d3qb5b_ a.118.16.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
msvseifvelqgflaaeqdireeirkvvqsleqtareiltllqgvhqgagfqdipkrclk
arehfgtvkthltslktkfpaeqyyrfhehwrfvlqrlvflaafvvyletetlvtreavt
eilgiepdrekgfhldvedylsgvlilaselsrlsvnsvtagdysrplhistfineldsg
frllnlkndslrkrydglkydvkkveevvydlsirgfn

Timeline for d3qb5b_:

• d3qb5b_ first appeared in SCOPe 2.01
  
• d3qb5b_ appears in SCOPe 2.05
  
• d3qb5b_ appears in SCOPe 2.07
  
• d3qb5b_ appears in the current release, SCOPe 2.08