Lineage for d3qb3a_ (3qb3 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2381452Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2381453Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2381454Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 2381455Protein Staphylococcal nuclease [50201] (1 species)
  7. 2381456Species Staphylococcus aureus [TaxId:1280] [50202] (258 PDB entries)
    Uniprot P00644 89-223
  8. 2381472Domain d3qb3a_: 3qb3 A: [184313]
    automated match to d1joka_
    complexed with ca, thp

Details for d3qb3a_

PDB Entry: 3qb3 (more details), 1.63 Å

PDB Description: Crystal structure of Staphylococcal nuclease variant Delta+PHS I92KL25A at cryogenic temperature
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d3qb3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qb3a_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvkamykgqpmtfrlllvdtpefnekygpeasaftkkmvenakki
evefdkgqrtdkygrglaykyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws

SCOPe Domain Coordinates for d3qb3a_:

Click to download the PDB-style file with coordinates for d3qb3a_.
(The format of our PDB-style files is described here.)

Timeline for d3qb3a_: