SCOPe 2.08: Domain d3qasa_: 3qas A:

Lineage for d3qasa_ (3qas A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156

4. Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families)
   the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase

5. Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins)
   automatically mapped to Pfam PF01255

6. Protein automated matches [190121] (4 species)
   not a true protein

7. Species Escherichia coli K-12 [TaxId:83333] [189661] (1 PDB entry)

8. Domain d3qasa_: 3qas A: [184311]
   automated match to d1jp3a_

Details for d3qasa_

PDB Entry: 3qas, 1.7 Å

PDB Description: Structure of Undecaprenyl Diphosphate synthase

PDB Compounds: (A:) undecaprenyl pyrophosphate synthase

SCOPe Domain Sequences for d3qasa_:

Sequence; same for both SEQRES and ATOM records:

>d3qasa_ c.101.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn
rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg
ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg
gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanr

Timeline for d3qasa_:

• d3qasa_ first appeared in SCOPe 2.01
  
• d3qasa_ appears in SCOPe 2.07