![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.101: Undecaprenyl diphosphate synthase [64004] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 342156 |
![]() | Superfamily c.101.1: Undecaprenyl diphosphate synthase [64005] (2 families) ![]() the sheet topology is similar to those of the N-terminal domain of phosphoglycerate kinase and carbamate kinase |
![]() | Family c.101.1.1: Undecaprenyl diphosphate synthase [64006] (2 proteins) automatically mapped to Pfam PF01255 |
![]() | Protein automated matches [190121] (4 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [189661] (1 PDB entry) |
![]() | Domain d3qasa_: 3qas A: [184311] automated match to d1jp3a_ |
PDB Entry: 3qas (more details), 1.7 Å
SCOPe Domain Sequences for d3qasa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qasa_ c.101.1.1 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]} gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafssenwn rpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntg ltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtg gehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanr
Timeline for d3qasa_: