Lineage for d3q9ud_ (3q9u D:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1445942Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. 1445943Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. 1445944Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
  6. 1446033Protein automated matches [190101] (6 species)
    not a true protein
  7. 1446045Species Escherichia coli [TaxId:562] [189927] (3 PDB entries)
  8. 1446051Domain d3q9ud_: 3q9u D: [184297]
    Other proteins in same PDB: d3q9ua_, d3q9ub_
    automated match to d1awcb_
    complexed with coa

Details for d3q9ud_

PDB Entry: 3q9u (more details), 2.3 Å

PDB Description: In silico and in vitro co-evolution of a high affinity complementary protein-protein interface
PDB Compounds: (D:) consensus ankyrin repeat

SCOPe Domain Sequences for d3q9ud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q9ud_ d.211.1.1 (D:) automated matches {Escherichia coli [TaxId: 562]}
afgqdlgkklleaaaagqddevrilmangadvnatddngltplhlaaangqleivevllk
ngadvnasdsagitplhlaaydghleivevllkhgadvnaydragwtplhlaalsgqlei
vevllkhgadvnaqdalgltafdisinqgqedlaeilq

SCOPe Domain Coordinates for d3q9ud_:

Click to download the PDB-style file with coordinates for d3q9ud_.
(The format of our PDB-style files is described here.)

Timeline for d3q9ud_: