![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies) multiple repeats of beta(2)-alpha(2) motif |
![]() | Superfamily d.211.1: Ankyrin repeat [48403] (2 families) ![]() repeats organized in elongated structures |
![]() | Family d.211.1.1: Ankyrin repeat [48404] (18 proteins) |
![]() | Protein automated matches [190101] (6 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [189927] (3 PDB entries) |
![]() | Domain d3q9ud_: 3q9u D: [184297] Other proteins in same PDB: d3q9ua_, d3q9ub_ automated match to d1awcb_ complexed with coa |
PDB Entry: 3q9u (more details), 2.3 Å
SCOPe Domain Sequences for d3q9ud_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q9ud_ d.211.1.1 (D:) automated matches {Escherichia coli [TaxId: 562]} afgqdlgkklleaaaagqddevrilmangadvnatddngltplhlaaangqleivevllk ngadvnasdsagitplhlaaydghleivevllkhgadvnaydragwtplhlaalsgqlei vevllkhgadvnaqdalgltafdisinqgqedlaeilq
Timeline for d3q9ud_: