SCOPe 2.01: Domain d3q9ub_: 3q9u B:

Lineage for d3q9ub_ (3q9u B:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.8: CoA-binding domain [51900] (6 proteins)

6. Protein automated matches [191286] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189926] (2 PDB entries)

8. Domain d3q9ub_: 3q9u B: [184295]
   Other proteins in same PDB: d3q9uc_, d3q9ud_
   automated match to d2d5aa1
   complexed with coa

Details for d3q9ub_

PDB Entry: 3q9u, 2.3 Å

PDB Description: In silico and in vitro co-evolution of a high affinity complementary protein-protein interface

PDB Compounds: (B:) CoA binding protein

SCOPe Domain Sequences for d3q9ub_:

Sequence, based on SEQRES records:

>d3q9ub_ c.2.1.8 (B:) automated matches {Escherichia coli [TaxId: 562]}
atrpidgltdegiretltrykkialvgaspkperdanivmkyllehgydvypvnpnyeev
lgrkcypsvldipdkievvdlfvnpakawrfvayaikkgakvvwfqyntyyplaarqakg
agliivanrcmmrehkrllg

Sequence, based on observed residues (ATOM records):

>d3q9ub_ c.2.1.8 (B:) automated matches {Escherichia coli [TaxId: 562]}
atrpidgltdegiretltrykkialvgaspkperdanivmkyllehgydvypvnpnyeev
lgrkcypsvldipdkievvdlfvnpakawrfvayaikkgakvvwfqyntyyplaagagli
ivanrcmmrehkrllg

Timeline for d3q9ub_:

• d3q9ub_ is new in SCOPe 2.01-stable
  
• d3q9ub_ appears in SCOPe 2.02
  
• d3q9ub_ appears in the current release, SCOPe 2.08