Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.8: CoA-binding domain [51900] (6 proteins) |
Protein automated matches [191286] (1 species) not a true protein |
Species Escherichia coli [TaxId:562] [189926] (2 PDB entries) |
Domain d3q9ub_: 3q9u B: [184295] Other proteins in same PDB: d3q9uc_, d3q9ud_ automated match to d2d5aa1 complexed with coa |
PDB Entry: 3q9u (more details), 2.3 Å
SCOPe Domain Sequences for d3q9ub_:
Sequence, based on SEQRES records: (download)
>d3q9ub_ c.2.1.8 (B:) automated matches {Escherichia coli [TaxId: 562]} atrpidgltdegiretltrykkialvgaspkperdanivmkyllehgydvypvnpnyeev lgrkcypsvldipdkievvdlfvnpakawrfvayaikkgakvvwfqyntyyplaarqakg agliivanrcmmrehkrllg
>d3q9ub_ c.2.1.8 (B:) automated matches {Escherichia coli [TaxId: 562]} atrpidgltdegiretltrykkialvgaspkperdanivmkyllehgydvypvnpnyeev lgrkcypsvldipdkievvdlfvnpakawrfvayaikkgakvvwfqyntyyplaagagli ivanrcmmrehkrllg
Timeline for d3q9ub_: