SCOPe 2.01: Domain d3q9nc_: 3q9n C:

Lineage for d3q9nc_ (3q9n C:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
   multiple repeats of beta(2)-alpha(2) motif

4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families)
   repeats organized in elongated structures

5. Family d.211.1.1: Ankyrin repeat [48404] (18 proteins)
   this is a repeat family; one repeat unit is 1ixv A:101-134 found in domain

6. Protein automated matches [190101] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189927] (2 PDB entries)

8. Domain d3q9nc_: 3q9n C: [184292]
   Other proteins in same PDB: d3q9na_, d3q9nb_
   automated match to d1awcb_
   complexed with cms, coa

Details for d3q9nc_

PDB Entry: 3q9n, 2 Å

PDB Description: In silico and in vitro co-evolution of a high affinity complementary protein-protein interface

PDB Compounds: (C:) consensus ankyrin repeat

SCOPe Domain Sequences for d3q9nc_:

Sequence; same for both SEQRES and ATOM records:

>d3q9nc_ d.211.1.1 (C:) automated matches {Escherichia coli [TaxId: 562]}
fgqdlgkklleaaaagqddevrilmangadvnatddngltplhlaaangqleivevllkn
gadvnasdsagitplhlaaydghleivevllkhgadvnaydragwtplhlaalsgqleiv
evllkhgadvnaqdalgltafdisinqgqedlaeilq

Timeline for d3q9nc_:

• d3q9nc_ is new in SCOPe 2.01-stable
  
• d3q9nc_ appears in SCOPe 2.02
  
• d3q9nc_ appears in the current release, SCOPe 2.08