Lineage for d3crda_ (3crd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332045Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 2332046Superfamily a.77.1: DEATH domain [47986] (5 families) (S)
  5. 2332115Family a.77.1.3: Caspase recruitment domain, CARD [81313] (6 proteins)
  6. 2332139Protein Raidd CARD domain [47995] (1 species)
  7. 2332140Species Human (Homo sapiens) [TaxId:9606] [47996] (1 PDB entry)
  8. 2332141Domain d3crda_: 3crd A: [18429]

Details for d3crda_

PDB Entry: 3crd (more details)

PDB Description: nmr structure of the raidd card domain, 15 structures
PDB Compounds: (A:) raidd

SCOPe Domain Sequences for d3crda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3crda_ a.77.1.3 (A:) Raidd CARD domain {Human (Homo sapiens) [TaxId: 9606]}
meardkqvlrslrlelgaevlveglvlqylyqegiltenhiqeinaqttglrktmllldi
lpsrgpkafdtfldslqefpwvreklkkareeamtdlpag

SCOPe Domain Coordinates for d3crda_:

Click to download the PDB-style file with coordinates for d3crda_.
(The format of our PDB-style files is described here.)

Timeline for d3crda_: