Lineage for d3q97b_ (3q97 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2009403Protein automated matches [190059] (14 species)
    not a true protein
  7. 2009425Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2009483Domain d3q97b_: 3q97 B: [184285]
    automated match to d1qkua_
    complexed with cl, fmt, gol, q97, srr

Details for d3q97b_

PDB Entry: 3q97 (more details), 2.1 Å

PDB Description: crystal structure of human estrogen receptor alpha lbd in complex with grip peptide and two isomers of ethoxy triphenylethylene
PDB Compounds: (B:) Estrogen receptor

SCOPe Domain Sequences for d3q97b_:

Sequence, based on SEQRES records: (download)

>d3q97b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
ifdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkit
dtlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllem
ldahr

Sequence, based on observed residues (ATOM records): (download)

>d3q97b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nslalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakr
vpgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmve
ifdmllatssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtl
ihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplsdlllemlda
hr

SCOPe Domain Coordinates for d3q97b_:

Click to download the PDB-style file with coordinates for d3q97b_.
(The format of our PDB-style files is described here.)

Timeline for d3q97b_: