| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) ![]() Common fold covers whole protein structure |
| Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
| Protein automated matches [190115] (94 species) not a true protein |
| Species Bacillus anthracis [TaxId:261594] [189622] (1 PDB entry) |
| Domain d3q94a_: 3q94 A: [184280] automated match to d1rv8a_ complexed with 13p, act, na, zn |
PDB Entry: 3q94 (more details), 2.3 Å
SCOPe Domain Sequences for d3q94a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3q94a_ c.1.10.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}
mplvsmkemlnkalegkyavgqfnmnnlewtqailaaaeeekspvilgvsegaarhmtgf
ktvvamvkalieemnitvpvaihldhgssfekckeaidagftsvmidashhpfeenvett
kkvveyaharnvsveaelgtvggqeddviaegviyadpaeckhlveatgidclapalgsv
hgpykgepnlgfaemeqvrdftgvplvlhggtgiptadiekaislgtskinvntenqief
tkavrevlnkdqevydprkfigpgrdaikatvigkirefgsngka
Timeline for d3q94a_: