Lineage for d3q94a_ (3q94 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2835965Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2835966Protein automated matches [190115] (94 species)
    not a true protein
  7. 2836090Species Bacillus anthracis [TaxId:261594] [189622] (1 PDB entry)
  8. 2836091Domain d3q94a_: 3q94 A: [184280]
    automated match to d1rv8a_
    complexed with 13p, act, na, zn

Details for d3q94a_

PDB Entry: 3q94 (more details), 2.3 Å

PDB Description: The crystal structure of fructose 1,6-bisphosphate aldolase from Bacillus anthracis str. 'Ames Ancestor'
PDB Compounds: (A:) Fructose-bisphosphate aldolase, class II

SCOPe Domain Sequences for d3q94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q94a_ c.1.10.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}
mplvsmkemlnkalegkyavgqfnmnnlewtqailaaaeeekspvilgvsegaarhmtgf
ktvvamvkalieemnitvpvaihldhgssfekckeaidagftsvmidashhpfeenvett
kkvveyaharnvsveaelgtvggqeddviaegviyadpaeckhlveatgidclapalgsv
hgpykgepnlgfaemeqvrdftgvplvlhggtgiptadiekaislgtskinvntenqief
tkavrevlnkdqevydprkfigpgrdaikatvigkirefgsngka

SCOPe Domain Coordinates for d3q94a_:

Click to download the PDB-style file with coordinates for d3q94a_.
(The format of our PDB-style files is described here.)

Timeline for d3q94a_: