![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.77: DEATH domain [47985] (1 superfamily) 6 helices: closed bundle; greek-key; internal pseudo twofold symmetry |
![]() | Superfamily a.77.1: DEATH domain [47986] (5 families) ![]() |
![]() | Family a.77.1.2: DEATH domain, DD [81312] (9 proteins) Pfam PF00531 |
![]() | Protein FADD (Mort1) [47992] (2 species) contains two domains of this superfamily: DED and DD, in this order |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47994] (1 PDB entry) |
![]() | Domain d1fada_: 1fad A: [18428] |
PDB Entry: 1fad (more details)
SCOPe Domain Sequences for d1fada_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fada_ a.77.1.2 (A:) FADD (Mort1) {Mouse (Mus musculus) [TaxId: 10090]} aappgeaylqvafdivcdnvgrdwkrlarelkvseakmdgieekyprslservreslkvw knaekknasvaglvkalrtcrlnlvadlveeaqes
Timeline for d1fada_: