SCOPe 2.08: Domain d3q90b1: 3q90 B:1-139

Lineage for d3q90b1 (3q90 B:1-139)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189642] (4 PDB entries)

8. Domain d3q90b1: 3q90 B:1-139 [184279]
   Other proteins in same PDB: d3q90b2
   automated match to d1zo2a1

Details for d3q90b1

PDB Entry: 3q90, 1.7 Å

PDB Description: Crystal structure of the NTF2 domain of Ras GTPase-activating protein-binding protein 1

PDB Compounds: (B:) Ras GTPase-activating protein-binding protein 1

SCOPe Domain Sequences for d3q90b1:

Sequence, based on SEQRES records:

>d3q90b1 d.17.4.0 (B:1-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldsngkpadavygqke
ihrkvmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapegsv
ankfyvhndifryqdevfg

Sequence, based on observed residues (ATOM records):

>d3q90b1 d.17.4.0 (B:1-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvmekpspllvgrefvrqyytllnqapdmlhrfygknssyvhggldpadavygqkeihrk
vmsqnftnchtkirhvdahatlndgvvvqvmgllsnnnqalrrfmqtfvlapefyvhndi
fryqdevfg

Timeline for d3q90b1:

• d3q90b1 first appeared in SCOPe 2.01, called d3q90b_
  
• d3q90b1 appears in SCOPe 2.07