SCOPe 2.05: Domain d3q8xd_: 3q8x D:

Lineage for d3q8xd_ (3q8x D:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.21: Plasmid maintenance system epsilon/zeta, toxin zeta subunit [82395] (2 proteins)
   similar to the nucleotide/nucleoside kinases; extra N- and C-terminal structures

6. Protein automated matches [191234] (1 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:1314] [189660] (1 PDB entry)

8. Domain d3q8xd_: 3q8x D: [184277]
   Other proteins in same PDB: d3q8xa_, d3q8xc_
   automated match to d1gvnd_
   complexed with so4, ud1

Details for d3q8xd_

PDB Entry: 3q8x, 2.7 Å

PDB Description: structure of a toxin-antitoxin system bound to its substrate

PDB Compounds: (D:) Zeta-toxin

SCOPe Domain Sequences for d3q8xd_:

Sequence; same for both SEQRES and ATOM records:

>d3q8xd_ c.37.1.21 (D:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
anivnftdkqfenrlndnleeliqgkkavesptafllggqpgsgktslrsaifeetqgnv
ividndtfkqqhpnfdelvklyekdvvkhvtpysnrmteaiisrlsdqgynlviegtgrt
tdvpiqtatmlqakgyetkmyvmavpkinsylgtieryetmyaddpmtaratpkqahdiv
vknlptnletlhktglfsdirlynregvklyssletpsispketlekelnrkvsgkeiqp
tlerieqkmvlnkhqetpefkaiqqkleslq

Timeline for d3q8xd_:

• d3q8xd_ first appeared in SCOPe 2.01
  
• d3q8xd_ appears in SCOPe 2.04
  
• d3q8xd_ appears in SCOPe 2.06
  
• d3q8xd_ appears in the current release, SCOPe 2.08