SCOPe 2.08: Domain d3q8xc_: 3q8x C:

Lineage for d3q8xc_ (3q8x C:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.2: Plasmid maintenance system epsilon/zeta, antidote epsilon subunit [81710] (1 family)
   automatically mapped to Pfam PF08998

5. Family a.8.2.1: Plasmid maintenance system epsilon/zeta, antidote epsilon subunit [81711] (2 proteins)
   dimeric

6. Protein automated matches [191233] (1 species)
   not a true protein

7. Species Streptococcus pyogenes [TaxId:1314] [189659] (1 PDB entry)

8. Domain d3q8xc_: 3q8x C: [184276]
   Other proteins in same PDB: d3q8xb_, d3q8xd_
   automated match to d1gvna_
   complexed with so4, ud1

Details for d3q8xc_

PDB Entry: 3q8x, 2.7 Å

PDB Description: structure of a toxin-antitoxin system bound to its substrate

PDB Compounds: (C:) Antidote of epsilon-zeta postsegregational killing system

SCOPe Domain Sequences for d3q8xc_:

Sequence; same for both SEQRES and ATOM records:

>d3q8xc_ a.8.2.1 (C:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
avtyektfeieiinelsasvynrvlnyvlnhelnkndsqllevnllnqlklakrvnlfdy
sleelqavheywrsmnryskqvlnk

Timeline for d3q8xc_:

• d3q8xc_ first appeared in SCOPe 2.01
  
• d3q8xc_ appears in SCOPe 2.07