Lineage for d3q8xb_ (3q8x B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871463Family c.37.1.21: Plasmid maintenance system epsilon/zeta, toxin zeta subunit [82395] (2 proteins)
    similar to the nucleotide/nucleoside kinases; extra N- and C-terminal structures
  6. 2871468Protein automated matches [191234] (1 species)
    not a true protein
  7. 2871469Species Streptococcus pyogenes [TaxId:1314] [189660] (1 PDB entry)
  8. 2871470Domain d3q8xb_: 3q8x B: [184275]
    Other proteins in same PDB: d3q8xa_, d3q8xc_
    automated match to d1gvnd_
    complexed with so4, ud1

Details for d3q8xb_

PDB Entry: 3q8x (more details), 2.7 Å

PDB Description: structure of a toxin-antitoxin system bound to its substrate
PDB Compounds: (B:) Zeta-toxin

SCOPe Domain Sequences for d3q8xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3q8xb_ c.37.1.21 (B:) automated matches {Streptococcus pyogenes [TaxId: 1314]}
nivnftdkqfenrlndnleeliqgkkavesptafllggqpgsgktslrsaifeetqgnvi
vidndtfkqqhpnfdelvklyekdvvkhvtpysnrmteaiisrlsdqgynlviegtgrtt
dvpiqtatmlqakgyetkmyvmavpkinsylgtieryetmyaddpmtaratpkqahdivv
knlptnletlhktglfsdirlynregvklyssletpsispketlekelnrkvsgkeiqpt
lerieqkmvlnkhqetpefkaiqqkleslqpp

SCOPe Domain Coordinates for d3q8xb_:

Click to download the PDB-style file with coordinates for d3q8xb_.
(The format of our PDB-style files is described here.)

Timeline for d3q8xb_: